PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00222g00715.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 311aa    MW: 35535 Da    PI: 8.2626
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00222g00715.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.7e-143982146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              rg+++ +E+  +++++++lG++ W++ a++++  Rt++++k++w++
  Peaxi162Scf00222g00715.1 39 RGKFSLQEERTIIQLHALLGNR-WSAMAAYLP-SRTDNEIKNYWNS 82
                              89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-5526IPR009057Homeodomain-like
PROSITE profilePS500904.53926IPR017877Myb-like domain
SuperFamilySSF466893.01E-162793IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-242988IPR009057Homeodomain-like
PROSITE profilePS5129422.2973488IPR017930Myb domain
SMARTSM007172.5E-143886IPR001005SANT/Myb domain
PfamPF002491.7E-133982IPR001005SANT/Myb domain
CDDcd001672.11E-94184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGKSKCCDKE GLKKGPWTPE EDQKLLLRWI NYLRPDIKRG KFSLQEERTI IQLHALLGNR  60
WSAMAAYLPS RTDNEIKNYW NSRLKKRLTK MGIDPMTHKP KTDNGNSSQS KYVANLSHMA  120
QWESARLEAE ARLVRRSKDS KMLFNNTHNY NQITSQPYYQ LPCLDILKAW QRSSTKPTTN  180
DINAILLDGN FATRNKSLES SIPSTSNNFS GNVVMNNVIT TTTTTTTTVG DNLPLSSINC  240
MDEDLCPSNF MQEFSELFPE YNTCAQNPEN YSTGQLDNFM GGCFLDFEDN KYFNWNNFSH  300
LVTSPVGSPV F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1812885108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621431.11e-147PREDICTED: protein ODORANT1-like
TrEMBLM1BKS81e-127M1BKS8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000474461e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-60myb domain protein 16